DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ceh-13 and Lim1

DIOPT Version :9

Sequence 1:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:60/169 - (35%) Gaps:44/169 - (26%)


- Green bases have known domain annotations that are detailed below.


 Worm    49 NYIMGN----GHVS-----------------PP---ATASGLSPPASRSSNSSAELPTGVT---- 85
            :|::|.    ||.|                 ||   |||.||........:|:.. |.|.:    
  Fly   140 DYLLGKAPSCGHNSLSDSLMGSASEDDDDDDPPHLRATALGLGVLGPNGPDSAGG-PLGTSDISV 203

 Worm    86 ASQHNTYKWMHTKRSQ-----------RPAAPKKKVIDENGTN----RTNFTTHQLTELEKEFHT 135
            .|.....|..|....|           ...|..|...|.||:.    ||.....||..|:..|:.
  Fly   204 QSMSTDSKNTHDDSDQGSLDGDPDGRGDSQAENKSPDDANGSKRRGPRTTIKAKQLEVLKTAFNQ 268

 Worm   136 AKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKREK 174
            .....|..|.::|....|....:::||||:|.||::.::
  Fly   269 TPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRMKQ 307

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 12/45 (27%)
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753