DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mapk-15 and rl

DIOPT Version :9

Sequence 1:NP_741165.1 Gene:mapk-15 / 175857 WormBaseID:WBGene00015478 Length:470 Species:Caenorhabditis elegans
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:342 Identity:145/342 - (42%)
Similarity:209/342 - (61%) Gaps:18/342 - (5%)


- Green bases have known domain annotations that are detailed below.


 Worm    19 LGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFREVMFLQEFGKHPNVIKLYNIFRAD 83
            :|:||||:|..|.|..:.:.||:||| ..|.:.|..|||.||:..|..| ||.|:|.:.:|.|.|
  Fly    44 IGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILTRF-KHENIIDIRDILRVD 106

 Worm    84 N---DRDIYLAFEFMEADLHNVIKKGSILKDVHKQYIMCQLFRAIRFLHSGNVLHRDLKPSNVLL 145
            :   .||:|:....||.||:.::|...:..| |..|.:.|:.|.::::||.|||||||||||:||
  Fly   107 SIDQMRDVYIVQCLMETDLYKLLKTQRLSND-HICYFLYQILRGLKYIHSANVLHRDLKPSNLLL 170

 Worm   146 DADCRVKLADFGLARSLSSLEDYPEGQKMPDLTEYVATRWYRSPEILLAAKRYTKGVDMWSLGCI 210
            :..|.:|:.||||||    :.| ||......|||||||||||:|||:|.:|.|||.:|:||:|||
  Fly   171 NKTCDLKICDFGLAR----IAD-PEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI 230

 Worm   211 LAEMLIGRALFPGSSTINQIERIMNTIAKPSRADIASIGSHYAASVLEKMPQRPRKPLDLIITQS 275
            |||||..|.:|||...::|:..|:..:..|||.|:..|.:..|.:.||.:|.:|..|...:...:
  Fly   231 LAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNA 295

 Worm   276 QTAAIDMVQRLLIFAPQKRLTVEQCLVHPYVVQFHNPSEEPVLNYEVYPPLPDHIQLSIDDY-RD 339
            ...|:|::.::|.|.|.||:.||:.|.|||:.|:::|.:|||..      :|..|.:..||. ||
  Fly   296 DALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAE------VPFRINMENDDISRD 354

 Worm   340 RLYEMIDEKKASFKRIQ 356
            .|..:|.|:...||..|
  Fly   355 ALKSLIFEETLKFKERQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mapk-15NP_741165.1 STKc_MAPK15-like 5..345 CDD:270841 140/329 (43%)
S_TKc 13..306 CDD:214567 127/289 (44%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 142/335 (42%)
S_TKc 38..326 CDD:214567 127/289 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.