DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DMP1 and CG15306

DIOPT Version :9

Sequence 1:XP_011530007.1 Gene:DMP1 / 1758 HGNCID:2932 Length:542 Species:Homo sapiens
Sequence 2:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster


Alignment Length:173 Identity:43/173 - (24%)
Similarity:73/173 - (42%) Gaps:14/173 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   343 KGDSQEDSKENLSQEESQNVDGPSSESSQEANLSSQENSSESQEEVVSESRGDNPDPTTSYVEDQ 407
            |.:..|||:....::|.....|...|.|  ..:.||......|:....:|.|.:     |..:|.
  Fly   184 KANQDEDSQHTDKKDEDSRDQGSQYEDS--PGMDSQYKDCRDQDSQYEDSHGKD-----SQYKDC 241

Human   408 EDSDSSEEDSSHTLSHSKSESREEQADSESSESLN--FSEESPESPEDENSSSQEGLQSHSSSAE 470
            .|..|..|| ||.:.....:||::.:..|.|..::  :.:...:..:.|:|..::..........
  Fly   242 RDQGSQYED-SHGMDSQYEDSRDQDSQYEDSPGMDSQYKDSRDQDSQYEDSHGKDSQYKDCRDQG 305

Human   471 SQSEESHSEEDD-SDSQDSSRSKEDSNSTESKSSSEEDGQLKN 512
            ||.|:||..:.. .||:|.....|||:   .|.|.:||.|.::
  Fly   306 SQYEDSHGMDSQYKDSRDQGCQYEDSH---GKDSEDEDSQYED 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DMP1XP_011530007.1 DMP1 30..542 CDD:284637 43/173 (25%)
CG15306NP_001259403.1 CH 20..103 CDD:278723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6151
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.