DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F17C8.6 and para

DIOPT Version :9

Sequence 1:NP_497974.1 Gene:F17C8.6 / 175626 WormBaseID:WBGene00008911 Length:279 Species:Caenorhabditis elegans
Sequence 2:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster


Alignment Length:247 Identity:45/247 - (18%)
Similarity:90/247 - (36%) Gaps:83/247 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm    42 RRVKFLLRLLKGRL--EVNDE-------------SDGLLFKHMCHEMERLHNGDDVSF-HDVLNM 90
            |.:....:|::.:|  :::|:             |:|   |.:|..:...|..:::.. ||.:..
  Fly  1076 RNIADCFKLIRNKLTNQISDQPSGERTNQISWIWSEG---KGVCRCISAEHGDNELELGHDEILA 1137

 Worm    91 LSYRSVDIRKSLQLEELLQREELEYIIEEEVAKHTIRAWLENCLKNIKAKQNNTLGKMSSIGSTF 155
            .......|::..|||..: .:.:|:.|..:             :||.|.|               
  Fly  1138 DGLIKKGIKEQTQLEVAI-GDGMEFTIHGD-------------MKNNKPK--------------- 1173

 Worm   156 AFPQSQEVLTKGVVLTEASPEEDSLQGDKGSGKKKAQRGNSITEIVAEAQKKSVKRATDKISERR 220
                      |...|..|:.::.:.....||.|.:..:.        |:.|.|.:  |.:..|:|
  Fly  1174 ----------KSKYLNNATDDDTASINSYGSHKNRPFKD--------ESHKGSAE--TMEGEEKR 1218

 Worm   221 GTLRQMQMGTYDELEEVEEDED--TDGEIRRSSFEYSGVDMIQMSHEKQLED 270
            ...:: .:|..:||:|..|.|:  .||            |:|..:|::.:.|
  Fly  1219 DASKE-DLGLDEELDEEGECEEGPLDG------------DIIIHAHDEDILD 1257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F17C8.6NP_497974.1 None
paraNP_001259619.1 Ion_trans 165..436 CDD:278921
Na_trans_cytopl 515..648 CDD:288761
Ion_trans 835..1028 CDD:278921
Na_trans_assoc 1054..1296 CDD:284034 45/247 (18%)
Ion_trans 1318..1571 CDD:278921
Na_channel_gate 1561..1613 CDD:240441
Ion_trans 1636..1871 CDD:278921
GPHH 1880..1930 CDD:293510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.