DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment idhg-1 and CG32026

DIOPT Version :9

Sequence 1:NP_497927.2 Gene:idhg-1 / 175598 WormBaseID:WBGene00009440 Length:396 Species:Caenorhabditis elegans
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:337 Identity:133/337 - (39%)
Similarity:208/337 - (61%) Gaps:14/337 - (4%)


- Green bases have known domain annotations that are detailed below.


 Worm    54 VTVLPGDGIGPEMLHHVERILSAVQAPVDFEVVNLT---SKEDASEDLAEAITAIKRNGVALKGN 115
            :|::||||||||:...|.:||.|.:.|:.||.|::|   :.:..:....:.|.::.|..|.|||.
  Fly   385 ITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKVGLKGP 449

 Worm   116 IETKFDNPSFVSRNLELRRQLNLYANVLHCSTIPTVPSRHTGIDMVIIRENTEGEYSGNEHEAVN 180
            :.|.. ...|.|.||.||:..|||||:..|.::|.|.:.:..:|:|.|||||||||||.||..||
  Fly   450 LMTPV-GTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGIEHTLVN 513

 Worm   181 APHPRVVESLKVVTREKSEQITRFAFQFAKKYGRKKVTAVHKANIQKLGDGLFLKVATDIA---- 241
            .    ||:|:|::||..|.::..:.||:|....|||||||.::.:.::.|||||:...::|    
  Fly   514 G----VVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAKYK 574

 Worm   242 -KAEYPDIEFNAMIVDNASMQLVSRPQQFDVMLMPNLYGNIISNIACGLVGGPGLVSGMNIGEDY 305
             |.:...|::....:....:.:|..|:::|::::|||||:|||:...||:||.||....|:|.:.
  Fly   575 SKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGTNG 639

 Worm   306 AVFETGTRNTGTTLAGKDLANPTAFIRAAVDMLRFLGLQSHADMISDSLFRTLVDKRIHTADIGG 370
            |:||: ...|...:||||||||||.:.::|.||.::||..|||.|..::.:|:.|..|.|.|:||
  Fly   640 AIFES-VHGTAPDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTMDLGG 703

 Worm   371 TSKSSELVQSVL 382
            .:|.||...:::
  Fly   704 KAKCSEYTDALI 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
idhg-1NP_497927.2 Iso_dh 49..383 CDD:294303 133/337 (39%)
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 133/337 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.