DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meis2 and achi

DIOPT Version :9

Sequence 1:XP_011237639.1 Gene:Meis2 / 17536 MGIID:108564 Length:559 Species:Mus musculus
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:183 Identity:57/183 - (31%)
Similarity:86/183 - (46%) Gaps:34/183 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse   359 QKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQ 423
            :|:||..||.:..|::.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||.:
  Fly    94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158

Mouse   424 S---------NRAGFLLDPSVSQGAAYS--------PEGQPMGSFVLD--------GQQHMGIRP 463
            .         :|.|..:.|:.|:.:|..        ..|.|....|:.        |:.|.||  
  Fly   159 EGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGI-- 221

Mouse   464 AGLQSMPGDYVSQGGPMG-MGMAQPSYTPPQMTPHPTQLRHGP----PMHSYL 511
            |.:.:....||.  ||.| |...:|.|....:......:.:.|    .:||.|
  Fly   222 ANVLTNFEQYVQ--GPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meis2XP_011237639.1 Meis_PKNOX_N 129..213 CDD:374576
Homeobox_KN 376..415 CDD:368670 21/38 (55%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.