DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H10E21.5 and APE3

DIOPT Version :9

Sequence 1:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:22/113 - (19%)
Similarity:42/113 - (37%) Gaps:29/113 - (25%)


- Green bases have known domain annotations that are detailed below.


 Worm   294 IADDFTIRLELGEQEHQAPSADVISPEANSDTSDSQGFSFDNSEHHHSESFGYGTSSTVPPQLVL 358
            :.||.....::..||.:|.|..:|              ||:.|:....:||...|:..:.|.:  
Yeast   124 VFDDMQDYYDVSLQEFEALSGKII--------------SFNLSDAETGKSFANTTAFALSPPV-- 172

 Worm   359 NASNAKSFV---MPLSSRGVSQGPQASRDFRSARAPRDHRASLHELPR 403
                 ..||   :.:.:.|..:     :|:.|...||.:...:..:.|
Yeast   173 -----DGFVGKLVEIPNLGCEE-----KDYASVVPPRHNEKQIALIER 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 7/30 (23%)
RING-H2_GRAIL 226..273 CDD:319582
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 22/113 (19%)
PA_ScAPY_like 155..284 CDD:239045 12/68 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.