DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H10E21.5 and rnf150b

DIOPT Version :9

Sequence 1:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans
Sequence 2:NP_001017554.1 Gene:rnf150b / 792211 ZFINID:ZDB-GENE-050417-470 Length:419 Species:Danio rerio


Alignment Length:156 Identity:84/156 - (53%)
Similarity:116/156 - (74%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


 Worm   156 SKTSVLFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRLFNAARKALTRIPTMTITPGMT 220
            |:|||:||||||||||:||||||||||:||||||:|:||.||||.:||:||::::...||..| .
Zfish   194 SRTSVVFVSISFIILMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISQLQVRTIRKG-D 257

 Worm   221 QELQSD---CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGY----- 277
            ||.:||   ||||::.|:..||:|:|||:|::||.|:||||::||||||||.:|||..|.     
Zfish   258 QETESDFDNCAVCIEGYKPNDVVRILPCRHLFHKCCVDPWLVDHRTCPMCKMNILKALGLTSSAE 322

 Worm   278 -WNDIRNDIQMPT-----NSRGIADD 297
             .|::..|.::..     |:..::||
Zfish   323 CLNELPLDYELAVGGVALNAMVMSDD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 84/156 (54%)
RING-H2_GRAIL 226..273 CDD:319582 29/49 (59%)
rnf150bNP_001017554.1 PA_GRAIL_like 45..182 CDD:239037
UPF0233 <196..>221 CDD:299753 22/24 (92%)
zf-RING_2 265..308 CDD:290367 25/42 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161007949
Domainoid 1 1.000 82 1.000 Domainoid score I5903
eggNOG 1 0.900 - - E33208_3BHU7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm12529
orthoMCL 1 0.900 - - OOG6_107948
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3602
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.