DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H10E21.5 and SPAP32A8.03c

DIOPT Version :9

Sequence 1:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:133 Identity:33/133 - (24%)
Similarity:56/133 - (42%) Gaps:42/133 - (31%)


- Green bases have known domain annotations that are detailed below.


 Worm   224 QSDCAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKNDILKHFGYWNDIRNDI--- 285
            :.:|.:|::.:::.|.:..|||||.:|::||.|||..:.||.:|:..:..:....|:...|.   
pombe   393 EGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTCAICRAPVDPNSQQRNNTSTDSANG 457

 Worm   286 QMPTNSRGIADDFTIRLELGEQEHQAPSADVISPEANSDTSDSQGFSFDN------------SEH 338
            ..|:|                  |..||         :.|::.||.:..|            |||
pombe   458 HNPSN------------------HANPS---------TSTTNDQGATLRNESFNAASQSNLSSEH 495

 Worm   339 HHS 341
            .||
pombe   496 GHS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 24/103 (23%)
RING-H2_GRAIL 226..273 CDD:319582 17/46 (37%)
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 16/42 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.