DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX4 and lab

DIOPT Version :10

Sequence 1:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:108 Identity:37/108 - (34%)
Similarity:50/108 - (46%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   121 RTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEG 185
            ||.:::.||..|.:.|...:||....|.::|..|.|.:|||||||||:|.|.||.:|      ||
  Fly   505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVK------EG 563

Human   186 DFPG-----RTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFG 223
            ..|.     .:.||....||..   ..|:...|.....|:..|
  Fly   564 LIPADILTQHSTSVISEKPPQQ---QQPQPPELQLKSQGSDLG 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120
Homeodomain 118..174 CDD:459649 23/52 (44%)
labNP_476613.1 Homeodomain 505..558 CDD:459649 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.