DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX4 and bsh

DIOPT Version :10

Sequence 1:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens
Sequence 2:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster


Alignment Length:209 Identity:66/209 - (31%)
Similarity:90/209 - (43%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    23 PVPSV--AAAYPLGLSPTTAAS-----PNLSYSRPYGHL-LSYPYTEPANPGDSYLSCQQPAALS 79
            |||:.  ....|..|:..:.||     ||..|: .:|.| ::..|..|::  .:|.|. .|..||
  Fly   178 PVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYT-DHGFLQMTLGYLSPSS--GTYKSV-DPYFLS 238

Human    80 Q-------PLCGPAEHPQELEADSEKPRLSPEPSE------------RRPQAPAKKLRKPRTIYS 125
            |       |..|             .|...||.:.            ||        ||.||::|
  Fly   239 QASLFGGAPFFG-------------APGCVPELALGLGMGVNALRHCRR--------RKARTVFS 282

Human   126 SLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQE------ 184
            ..||..|.:||:..:||:.|||.:||..|||::||||.||||:|.|:||.|::.....|      
  Fly   283 DPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSR 347

Human   185 ---GDFPGRTFSVS 195
               |..||...|.|
  Fly   348 SEPGKQPGEATSSS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 9/58 (16%)
Homeodomain 118..174 CDD:459649 30/55 (55%)
bshNP_477350.2 Homeodomain 275..331 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.