DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX4 and CG11085

DIOPT Version :10

Sequence 1:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens
Sequence 2:NP_572815.3 Gene:CG11085 / 32213 FlyBaseID:FBgn0030408 Length:295 Species:Drosophila melanogaster


Alignment Length:159 Identity:43/159 - (27%)
Similarity:66/159 - (41%) Gaps:61/159 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    84 GPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERA 148
            |.|||..:|.....|||       ||           ||.::..||.:|.::|:..:||::.:|:
  Fly   145 GYAEHKLQLSKSGRKPR-------RR-----------RTAFTHAQLAYLERKFRCQKYLSVADRS 191

Human   149 QLAAQLGLTQTQVKIWFQNKRSKYKK------------------LLKQNSGGQEGDFPGRTFSVS 195
            .:|..|.|::||||.|:||:|:|:|:                  .:.|:.||..|         .
  Fly   192 DVAETLNLSETQVKTWYQNRRTKWKRQNQLRLEQLRHQATMEKDFVVQDGGGAGG---------L 247

Human   196 PCSPPLPSLWDLPKAGTLPTSGYGNSFGA 224
            .|.|                ||..:||.|
  Fly   248 GCCP----------------SGLSSSFSA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 10/35 (29%)
Homeodomain 118..174 CDD:459649 21/55 (38%)
CG11085NP_572815.3 Homeodomain 161..217 CDD:459649 24/73 (33%)

Return to query results.
Submit another query.