DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX3 and Dr

DIOPT Version :10

Sequence 1:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens
Sequence 2:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster


Alignment Length:114 Identity:45/114 - (39%)
Similarity:68/114 - (59%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   113 EEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWF 177
            |.|..:..:...||.  |||||.:::.||.:|:::|::.|||::.||||.::.|.||:|||||||
  Fly   407 EPPRIKCNLRKHKPN--RKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWF 469

Human   178 QNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSP-ALWDTSSHSTPA 225
            ||||:|.|:|.   |..:|     ...||.....:| |.|..:.:..|:
  Fly   470 QNRRAKAKRLQ---EAEIE-----KIKMAALGRGAPGAQWAMAGYFHPS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 45/114 (39%)
homeobox 129..188 32/58 (55%)
Homeodomain 130..186 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 7/32 (22%)
DrNP_477324.1 Homeodomain 422..478 CDD:459649 31/55 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.