DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX3 and ems

DIOPT Version :10

Sequence 1:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens
Sequence 2:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster


Alignment Length:81 Identity:34/81 - (41%)
Similarity:49/81 - (60%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   125 KPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLY- 188
            |||::   ||.:|..||..|:..|:..||:...||..||..|.|::||||:||||||:|.|::. 
  Fly   387 KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448

Human   189 ---KNGEVPLEHSPNN 201
               |.||...:.:.:|
  Fly   449 EDEKGGEGGSQRNMHN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 34/81 (42%)
homeobox 129..188 27/58 (47%)
Homeodomain 130..186 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 1/7 (14%)
emsNP_731868.1 Homeodomain 389..445 CDD:459649 27/58 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.