DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX3 and Antp

DIOPT Version :10

Sequence 1:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:183 Identity:51/183 - (27%)
Similarity:78/183 - (42%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    50 YYSGQPYGQ----------TVNPYTYHHQFNL----NGLAGTGAYSPKSEYTYGASYRQ--YGAY 98
            ::.|.|..|          ....:..||...:    :|:...|| .|:.....|....|  .|..
  Fly   199 HHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGA-PPQGMMHQGQGPPQMHQGHP 262

Human    99 REQPLPAQDPVSVKEEPEAE----VRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPER 159
            .:...|:|:|.|......:.    :|...||.::.::.|..|:.||...|::.|...:||....|
  Fly   263 GQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRR 327

Human   160 AELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPS 212
            .|:|..|.||:.|:||||||||.|:||..|....|  .|....|.:   :||:
  Fly   328 IEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEP--GSGGEGDEI---TPPN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567 13/72 (18%)
COG5576 <109..232 CDD:227863 36/108 (33%)
homeobox 129..188 26/58 (45%)
Homeodomain 130..186 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 4/18 (22%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 21/107 (20%)
Homeodomain 298..354 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.