DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX3 and zen2

DIOPT Version :10

Sequence 1:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:198 Identity:59/198 - (29%)
Similarity:85/198 - (42%) Gaps:45/198 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   109 VSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQV 173
            ::|:..|.|..|    ..:|.::.||.:||.||..|:|.|...:|||...|.|::.:|.||:.||
  Fly    27 LNVEAAPTATTR----SSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQV 87

Human   174 KIWFQNRRSKFKK-LYKNG-------EVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPAR-- 228
            ||||||||.|.|| ..:.|       .:||. |.::.|....:......|...:::...||.|  
  Fly    88 KIWFQNRRMKLKKSTNRKGAIGALTTSIPLS-SQSSEDLQKDDQIVERLLRYANTNVETAPLRQV 151

Human   229 -------SQLPPPL-------PYSASPSYLDD-PTN--------SWYH-------AQNLSGPHLQ 263
                   .|:.||.       .:|..|..|.. |.|        ||..       |:|:...:.|
  Fly   152 DHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNTQ 216

Human   264 QQP 266
            .||
  Fly   217 DQP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 45/139 (32%)
homeobox 129..188 30/59 (51%)
Homeodomain 130..186 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 22/104 (21%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.