DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX3 and eve

DIOPT Version :10

Sequence 1:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:215 Identity:62/215 - (28%)
Similarity:94/215 - (43%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    94 QYGAYREQPLPAQDPVSVKEEPEAEVRMVNGK-------PKKVRKPRTIYSSYQLAALQRRFQKA 151
            |||.      |...|.|..|...:....:||.       ...||:.||.::..||..|::.|.|.
  Fly    34 QYGK------PQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKE 92

Human   152 QYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK-----------LYKNGEVPLEHSPNNSDSM 205
            .|::.|.|.||||||.|.::.:|:||||||.|.|:           :|.:...........::|:
  Fly    93 NYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSV 157

Human   206 ACNSPP-SPALWDTSSHSTPAPARSQLP------PPLPYSASPSYLDDPTNSWYHAQNLSGPHLQ 263
            ....|| :||   .::.:..|.|.:..|      ||:.....|: :..|.:|. ||.:.| |:.|
  Fly   158 GMPYPPYAPA---AAAAAAAAAAVATNPMMATGMPPMGMPQMPT-MQMPGHSG-HAGHPS-PYGQ 216

Human   264 QQ------PPQPATLHHASP 277
            .:      |.:||..|.|.|
  Fly   217 YRYTPYHIPARPAPPHPAGP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567 4/12 (33%)
COG5576 <109..232 CDD:227863 40/141 (28%)
homeobox 129..188 28/69 (41%)
Homeodomain 130..186 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 24/96 (25%)
eveNP_523670.2 Homeodomain 71..127 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.