DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLX3 and B-H2

DIOPT Version :10

Sequence 1:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens
Sequence 2:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:92/233 - (39%) Gaps:82/233 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   127 KKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSK-------- 183
            ||.||.||.::.:||..|::.|::.:||::.:|.|||.:|.|:..|||.|:||||:|        
  Fly   378 KKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVG 442

Human   184 ------------FKKLYKNGEVP-----------LEHSPNNSD-------------SMACNSPPS 212
                        |::|| .|..|           ...||:.:.             :.|...|..
  Fly   443 LELLAEAGNYAAFQRLY-GGATPYLSAWPYAAAAAAQSPHGATPSAIDIYYRQAAAAAAMQKPSL 506

Human   213 PALWDTSSHSTPAPARS--QLPPPLPYSASPSYLDDPTNSWYH------AQNLSGPHLQQQPP-- 267
            ||.:.....|.| |..|  .:|.|.|..|:|..      |.|:      |.:......|||||  
  Fly   507 PASYRMYQSSIP-PGMSLPGMPAPPPPGAAPML------SGYYAAAAAAAASAGAQQQQQQPPAA 564

Human   268 --QPATLHHA------------------SPGPPPNPGA 285
              .|||...|                  :|.||.|||:
  Fly   565 SRSPATSQSANSEADCERTSSSSRQRLITPSPPLNPGS 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 42/150 (28%)
homeobox 129..188 26/78 (33%)
Homeodomain 130..186 CDD:459649 26/75 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 33/134 (25%)
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.