DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mos and slpr

DIOPT Version :9

Sequence 1:NP_064405.2 Gene:Mos / 17451 MGIID:97052 Length:343 Species:Mus musculus
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:317 Identity:83/317 - (26%)
Similarity:149/317 - (47%) Gaps:78/317 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    50 PRRLAWFSIDWEQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRS--------F 106
            |..:.:..:|.::|     :|||||..|::..|.|..||||..::..:|.....|.        |
  Fly   121 PHEIEYNELDIKEV-----IGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLF 180

Mouse   107 WAELNIARLRHDNI--VRVVAASTRTPEDSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQ 169
            ||      |:|:||  :|.|..:|:.        .::||:....:|::::.|.. .|:.|     
  Fly   181 WA------LKHENIAALRGVCLNTKL--------CLVMEYARGGSLNRILAGKI-PPDVL----- 225

Mouse   170 LSLGKCLKYSLDVVNGLLFLHSQ---SILHLDLKPANILISE--------QDVCKISDFGCSQKL 223
                  :.:::.:..|:.:||::   ||:|.|||.:|:||.|        |...||:|||.::::
  Fly   226 ------VNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREM 284

Mouse   224 QDLRCRQASPHHIGGTYTHQAPEILKGEIATPKADIYSFGITLWQMTTREVPYSG-EPQYVQYAV 287
            .:.:...|:     |||....||::.....:..:|::|:|:.||::.|.|.||.| :|..|.|.|
  Fly   285 YNTQRMSAA-----GTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGV 344

Mouse   288 VAYNLR-------PSLAGAVFTASLTGKTLQNIIQSCWEARALQRPGAELLQRDLKA 337
            ....|.       |...||             :::|||:....:|||.:.:.:.|::
  Fly   345 AVNTLTLPIPKTCPETWGA-------------LMKSCWQTDPHKRPGFKEILKQLES 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MosNP_064405.2 STKc_Mos 59..335 CDD:270881 81/304 (27%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 81/305 (27%)
STKc_MLK 134..389 CDD:270963 81/304 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.