DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment R09D1.12 and btl

DIOPT Version :9

Sequence 1:NP_496025.2 Gene:R09D1.12 / 174501 WormBaseID:WBGene00011168 Length:455 Species:Caenorhabditis elegans
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:431 Identity:127/431 - (29%)
Similarity:205/431 - (47%) Gaps:70/431 - (16%)


- Green bases have known domain annotations that are detailed below.


 Worm    32 ALFAYGIFVGIFVLICHIRRAFESI------NIQQYTNR----------GNAIRNSYVQVQTEIT 80
            |||..|.....|:| ..:||  |.:      .:.|:|.:          |:...:..:|:     
  Fly   612 ALFLLGSAFITFML-RRLRR--EKLLKLRIETVHQWTKKVIIYRPGGEEGSGCSSGDLQM----- 668

 Worm    81 PSSILAVQENTLGIEST-NKEPTQPINERAEKLPYNPAFEIQPNNLDTFNRKLGKGKFGII---- 140
            |...:..|..|:....| ..:|.|..||  .:.|.:..:|| |....:....||:|.||.:    
  Fly   669 PVIRIEKQRTTVSTTGTGGTDPAQGFNE--YEFPLDSNWEI-PRQQLSLGSILGEGAFGRVVMAE 730

 Worm   141 NKGLLTLRICKTNEVVQVNVAVKKMVDP-TDEKQDKLIYDEIKLMCAIGKHPNVLAIVGAITKKE 204
            .:||     .::.::.:..||||.:.:. ||.....|: .|:::|..||||.|::.::|..::..
  Fly   731 AEGL-----PRSPQLAETIVAVKMVKEEHTDTDMASLV-REMEVMKMIGKHINIINLLGCCSQGG 789

 Worm   205 KVSGREYNQAVSEFIEGGDLRSVLR-NSPYTFQDEITSRERTGGQNVDAEVFDT--ISTSDLFSF 266
            .:      ..:.|:...|:|:..|: |.|...|    .|..:.|...|..:..|  :...:|..|
  Fly   790 PL------WVIVEYAPHGNLKDFLKQNRPGAPQ----RRSDSDGYLDDKPLISTQHLGEKELTKF 844

 Worm   267 AYQIANGMEYLASLPCVHRDLALRNVFVKKNKIIRIGDFGLARHNGDKDYYKVKYSPETPLPIFW 331
            |:|||.|||||||..|:|||||.|||.|....:::|.||||||...|.:||:...:..  |||.|
  Fly   845 AFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGR--LPIKW 907

 Worm   332 LAPECFDDGTSFTEMTDVWSYGVCLFELFSLGASPY-----LEEFQNFFDPIYYVVAFLESGKRL 391
            :|||...: ..:...:|||||||.|:|:.:.|..||     .||          :.::|.:|:|:
  Fly   908 MAPESLQE-KKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEE----------LYSYLITGQRM 961

 Worm   392 SSPKYCRSDIYNFMLECWNSDAKQRPRFTKCKEFFKNLIKR 432
            ..|..|..:||..|.:||:.::..||.|.:..|.|..::::
  Fly   962 EKPAKCSLNIYVVMRQCWHFESCARPTFAELVESFDGILQQ 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
R09D1.12NP_496025.2 TyrKc 127..426 CDD:197581 101/311 (32%)
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 106/329 (32%)
TyrKc 712..996 CDD:197581 101/312 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.