DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chil-13 and Cht10

DIOPT Version :9

Sequence 1:NP_496018.2 Gene:chil-13 / 174500 WormBaseID:WBGene00010945 Length:439 Species:Caenorhabditis elegans
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:398 Identity:92/398 - (23%)
Similarity:174/398 - (43%) Gaps:79/398 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm    65 NLVLNNES--PKKPVCKRRIVGYFS---------------EIESTEISKSQIDKLTHAVFAFVRI 112
            |.||..|:  ..:...:.:|:.||:               :|:|        |..||.::.|..:
  Fly  1392 NHVLEEENIEATEMATEFKIICYFTNWAWYRQGGGKFLPEDIDS--------DLCTHIIYGFAVL 1448

 Worm   113 KYDG-TLQFDNSKADL--RF--SILKDKTRGSNVEMMVSIGGGYENA-HYFASALSDSQKKKNFI 171
            ..|. |:|..:|.|||  :|  .|:..:.:|:.|  .|:|||..::| ..::..:.:.:.:..||
  Fly  1449 SRDNLTIQPHDSWADLDNKFYERIVAYRKKGAKV--TVAIGGWNDSAGDKYSRLVRNPEARSRFI 1511

 Worm   172 DSILAFLVEHRIDGVDFFWQWP----------TVQDTFNYVTFIRELRQKLDENKRKHFLISMTV 226
            .::|.|:.|:..||:|..|::|          |.::...:...:|||.......       .:.:
  Fly  1512 RNVLDFIEEYNFDGLDLDWEYPVCWQVDCKKGTAEEKIGFSALVRELFYAFQPR-------GLIL 1569

 Worm   227 PAAGVDNWEL---GFDLEELQNHVDFFNVYSMDYAGPWPNQWGVPTGPSSPMFYNIGARKNFYVD 288
            .||...|.::   |:::.||.::..:.:|.:.||.|    ||...||..:||:.:.....||..:
  Fly  1570 SAAVSPNKKVIDAGYEVAELSHYFSWISVMAYDYHG----QWDKKTGHVAPMYSHPEGTANFNAN 1630

 Worm   289 WTMKHYTCKLKQPSMLNMVIPFSARIWNNVQEAIDNRTEVFRNAELKNNMAEGR-TQISRWTAEH 352
            ::|.::.........|.|.||...:.:     ::...|:...||........|. |:...:.|.:
  Fly  1631 FSMNYWISMGADRRKLVMGIPLYGQSF-----SLAETTKHQLNAPTYGGGEAGEATRARGFLAYY 1690

 Worm   353 E-GLELSPSSWDNLTMTPYILDLKAK---------TFLTFEDKRSIKIKTDYAKKMDLGGVWLWS 407
            | .|::....|:      .:.|.|.:         .:::|:|...|:.|::|.|.|.|||..:|:
  Fly  1691 EICLKIRHHRWN------VVRDTKGRIGPFAYHGDQWVSFDDVPMIRHKSEYIKAMGLGGAMIWA 1749

 Worm   408 VDMDDRLN 415
            :|:||..|
  Fly  1750 LDLDDFKN 1757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chil-13NP_496018.2 Glyco_18 81..411 CDD:214753 85/374 (23%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 85/374 (23%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 88/379 (23%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164222
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.