DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y51B9A.9 and rl

DIOPT Version :9

Sequence 1:NP_496002.1 Gene:Y51B9A.9 / 174489 WormBaseID:WBGene00013091 Length:381 Species:Caenorhabditis elegans
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:335 Identity:113/335 - (33%)
Similarity:177/335 - (52%) Gaps:43/335 - (12%)


- Green bases have known domain annotations that are detailed below.


 Worm     5 EILNEVLFIVPNRYVDLLPSQFGN---AMEVIAFDQISERRVVIKKVVLPENFDNWQHWRRAQRE 66
            |::...:|.|..||:.|  :..|.   .|.|.|.|.::.:||.|||:   ..|::..:.:|..||
  Fly    25 EVIRGQIFEVGPRYIKL--AYIGEGAYGMVVSADDTLTNQRVAIKKI---SPFEHQTYCQRTLRE 84

 Worm    67 LFCTLHIQEENFVKMYSIYTWVETVEEMREFYTVREYMDWNLRNFILSTPEKLDHKVIKSIFFDV 131
            :......:.||.:.:..|.. |:::::||:.|.|:..|:.:|  :.|...::|.:..|....:.:
  Fly    85 ITILTRFKHENIIDIRDILR-VDSIDQMRDVYIVQCLMETDL--YKLLKTQRLSNDHICYFLYQI 146

 Worm   132 CLAVQYMHSIRVGHRDLKPENVLINYEAIAKISGFAHANREDP------FVNTPYIVQRFYRAPE 190
            ...::|:||..|.||||||.|:|:|.....||..|..|...||      |: |.|:..|:|||||
  Fly   147 LRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFL-TEYVATRWYRAPE 210

 Worm   191 ILCETMDNNKPSVDIWSLGCILAELLTGKILFTGQTQIDQFFQIVRFLGNP---DLSFYMQMPDS 252
            |:..:....| |:||||:||||||:|:.:.:|.|:..:||...|:..||:|   ||...:.  :.
  Fly   211 IMLNSKGYTK-SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIIN--EK 272

 Worm   253 ARTFFLGLPMNQYQKPTNI--HEHFPNSLFLDTMISEPIDCDLARDLLFRMLVINPDDRIDIQKI 315
            ||.:...||.    || |:  .:.|||:           |. ||.|||.:||..||..||.:::.
  Fly   273 ARNYLESLPF----KP-NVPWAKLFPNA-----------DA-LALDLLGKMLTFNPHKRIPVEEA 320

 Worm   316 LVHPYLEEVW 325
            |.|||||:.:
  Fly   321 LAHPYLEQYY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y51B9A.9NP_496002.1 PKc_like 17..325 CDD:389743 110/321 (34%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 112/328 (34%)
S_TKc 38..326 CDD:214567 106/316 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.