DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment skpo-1 and Spf45

DIOPT Version :9

Sequence 1:NP_495768.1 Gene:skpo-1 / 174340 WormBaseID:WBGene00009897 Length:655 Species:Caenorhabditis elegans
Sequence 2:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster


Alignment Length:154 Identity:30/154 - (19%)
Similarity:58/154 - (37%) Gaps:44/154 - (28%)


- Green bases have known domain annotations that are detailed below.


 Worm   471 MMTVPVRSPQRLTTSVTERLFGGSVDMAAVNIQRGRDHGLRSYNDYRRF--------CNLRPITS 527
            :::.|:.|.:.| .|:.||:..|..|:|       .::..:..|:|.:.        .|...::.
  Fly    66 VVSKPLISGKAL-PSILERINRGDWDVA-------DEYDPQRPNEYEKLKEKSNGSDKNRAGVSD 122

 Worm   528 FNDWPEVPDENVRQRIGQLYRTPDDLDFYVGGILEQPAAGSLLGATFACVIGKQFERLRDGDRFY 592
            ..|..:...:..|.|:|:       .:||    .::.:|.:|..:.|.       .|..|.| .|
  Fly   123 REDRDDKEKDRKRGRVGR-------REFY----RDEVSAPNLKLSGFG-------HRQNDDD-MY 168

 Worm   593 YENPGVFTS---------PQLAEL 607
            ..:||:...         |.|.|:
  Fly   169 LPSPGLVAKQGGATIAPPPSLQEM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
skpo-1NP_495768.1 ShKT 22..56 CDD:214586
An_peroxidase 143..623 CDD:281139 30/154 (19%)
peroxinectin_like 275..619 CDD:188655 30/154 (19%)
Spf45NP_001036426.1 G-patch 209..248 CDD:279867
RRM_UHM_SPF45 307..402 CDD:241091
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.