DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fust-1 and caz

DIOPT Version :9

Sequence 1:NP_495483.1 Gene:fust-1 / 174175 WormBaseID:WBGene00016173 Length:448 Species:Caenorhabditis elegans
Sequence 2:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster


Alignment Length:407 Identity:158/407 - (38%)
Similarity:194/407 - (47%) Gaps:93/407 - (22%)


- Green bases have known domain annotations that are detailed below.


 Worm    46 YGGHDQAQQPQNPYAPPPPGADPYGQGSGGQSGGSDPYGQSRGGGRGGFGGSRGGGGYDGGRG-- 108
            |||  .:.|..|.:|.|||........:|..:.....||:.             |||||.|.|  
  Fly     6 YGG--GSGQGYNNFAVPPPNYQQMPNKTGNYNEPPPNYGKQ-------------GGGYDSGSGHR 55

 Worm   109 GSRG-GYDGGRGGYGGDRGGRGGGRGGYDGERRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDG 172
            ||.| |..||.||...||||...|        .||:..|..|.        |.|||...|     
  Fly    56 GSGGSGNGGGGGGSWNDRGGNSYG--------NGGASKDSYNK--------GHGGYSGGG----- 99

 Worm   173 PPSGGGYGGGGAASGNREFGSDGRVELKETVFVQGISTTANEAYIADVFSTCGDIAKNDR--GPR 235
               |||.||||..||    |:| .:..::|:||.|:..:..|..|...|...|.|.|:.|  .|:
  Fly   100 ---GGGGGGGGGGSG----GND-MITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPK 156

 Worm   236 IKIYTDRNTGEPKGECMITFVDASAAQQAITMYNGQPFPGGSSPMSISLAKFRADAGGERGGRGG 300
            |.:|.::.||..|||..:|:.|.:|||.||..::|:.|.|.:  :.:|||        :|.....
  Fly   157 IWLYKNKETGASKGEATVTYDDTNAAQSAIEWFDGRDFNGNA--IKVSLA--------QRQNNWN 211

 Worm   301 RGGFGGGRGGPMGGRGGFGGDRGGYGGGGGRGGFDGGRGGGGGFRGGDRGGFRGGDRGGFRGGDR 365
            :||.|||.|   ||||||||.|||.||||      ||.||||.|           ||||..||.|
  Fly   212 KGGGGGGGG---GGRGGFGGRRGGGGGGG------GGGGGGGRF-----------DRGGGGGGGR 256

 Worm   366 GGFRGGDRGGDRGGFRGGRGVGGGNANMEQRKNDWPCEQCGNSNFAFRRECNQCQAPRPD--GGS 428
                 .||||..||       |||..|::.|..||.|..|.|:|||:|.|||:|:.|:.|  |.|
  Fly   257 -----YDRGGGGGG-------GGGGGNVQPRDGDWKCNSCNNTNFAWRNECNRCKTPKGDDEGSS 309

 Worm   429 GGGGGERRGGPPGGDRY 445
            |||||...||..||..|
  Fly   310 GGGGGGGYGGGGGGGGY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fust-1NP_495483.1 RRM <202..>290 CDD:223796 32/89 (36%)
RRM_FET 203..284 CDD:240726 28/82 (34%)
ZnF_RBZ 398..421 CDD:197784 13/22 (59%)
cazNP_523365.2 RRM <118..>205 CDD:223796 32/96 (33%)
RRM_SARFH 122..204 CDD:240978 29/83 (35%)
zf-RanBP 275..304 CDD:279035 15/28 (54%)
RanBP2-type Zn finger 279..298 CDD:275375 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158958
Domainoid 1 1.000 53 1.000 Domainoid score I7605
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I2395
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49372
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23238
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X712
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.