DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B0252.3 and CG33233

DIOPT Version :9

Sequence 1:NP_001021888.1 Gene:B0252.3 / 174130 WormBaseID:WBGene00015088 Length:484 Species:Caenorhabditis elegans
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:443 Identity:96/443 - (21%)
Similarity:169/443 - (38%) Gaps:147/443 - (33%)


- Green bases have known domain annotations that are detailed below.


 Worm    82 EFDLT-GDASWLAESTTTFYMVGNMI-GGMFIPPLADHYGRLPVFVATVLLMAVGGM----ISAF 140
            |||.: .:.:.||.|     ::|.|: .|:||..|||.|||  .||  :.|..||.:    |||.
  Fly    50 EFDTSPKEKTLLANS-----LLGGMVASGLFIGFLADRYGR--KFV--IRLALVGALSFSVISAL 105

 Worm   141 STSIMMFCIMRMIHGIFYTAAGLAGWVLGYENTPLRLRFFTSVYFGVMW---VVGAC-------- 194
            ...:....::|:|.|.|.:|  :|...:|          |...:..:.|   .|..|        
  Fly   106 MPDLYSLSVIRIIVGTFLSA--VASLQVG----------FLGEFHAIKWRPITVAICSQSQGLAL 158

 Worm   195 -FLGLLAY-ILPD--------------WRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEK 243
             :..|:|. |||:              ||:||....:|. ::||:....|||:.|||:|..:.:|
  Fly   159 IYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMMFFMIPG-WLALVGICLVPETPHFLMSVNRPDK 222

 Worm   244 ---IEAWLEKIRGPKG---DISASDIVEDRDENGSSFKTLCREMWKHKMFIVYVLVMTYIWIVDT 302
               ...|:.::...|.   ||:.|:.....::....:||    :| ::..:::.....:.:.:..
  Fly   223 ALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGFWKT----VW-YEYKLLFSKPHVFKFFICL 282

 Worm   303 FIYFGLAFYS-----------------------------------------------------TN 314
            |:.||:.|.|                                                     ||
  Fly   283 FLIFGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTN 347

 Worm   315 LAGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLISGTHIIAGLSFLGIVLSSEAWHIHFWLLG 379
            |...:|..|..:.     .:|.:.:.::...||.:|: .||:..: .|||.|:         ::.
  Fly   348 LIDPVYYGFTYIG-----CFILASVLVHWMTRKYVIA-LHILISM-ILGISLN---------IMK 396

 Worm   380 KFAISCSFMSIYM--------FASEI----FPTDGRNKCIGFCETLSRFGGML 420
            :..:...|..:.|        .|:.:    .|.:.|.|.:....:|:||||:|
  Fly   397 QPTVVLIFFVLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRSLARFGGVL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B0252.3NP_001021888.1 MFS 87..454 CDD:119392 93/437 (21%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 96/443 (22%)
MFS 23..>208 CDD:119392 48/179 (27%)
MFS 354..>482 CDD:304372 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.