DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLG3 and SPBC1198.05

DIOPT Version :9

Sequence 1:XP_006724688.1 Gene:DLG3 / 1741 HGNCID:2902 Length:849 Species:Homo sapiens
Sequence 2:NP_595074.1 Gene:SPBC1198.05 / 2539674 PomBaseID:SPBC1198.05 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:56/182 - (30%)
Similarity:95/182 - (52%) Gaps:11/182 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   660 RPVIILGPM---KDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDN 721
            :||::.||.   |..:...|:.:...|.|..|.||||..|..|.||.|||| |::|:.:|.:.:.
pombe    19 KPVVVFGPSGVGKSTLLKRLLKDHGDKLGFSVSHTTRTPRAGEKDGIDYHF-VTKEEFQKLVAEE 82

Human   722 KFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEM 786
            ||:|...|:.|:|||||.:::.:....|..|||:....:.:::.:.:....:|:.|.|||.|...
pombe    83 KFVEWAVFSGNMYGTSIMAIQELEAVNKKAILDIDLQGVLQVKASPIDAQYVFLAPPSIEQLEVR 147

Human   787 NRRQTYEQANKIYDKAMKLEQEFGEY------FTAIVQGDSLEEIYNKIKQI 832
            .|.:..|..:.|..:..:...|. ||      |.|::..|.:|:.|.:::.|
pombe   148 LRGRGTENESAILQRLERARAEI-EYSEKPGNFDALIVNDDVEKAYKQLEAI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLG3XP_006724688.1 MAGUK_N_PEST 52..130 CDD:402306
PDZ_signaling 131..208 CDD:238492
PDZ_signaling 224..310 CDD:238492
PDZ_assoc 311..385 CDD:402299
PDZ_signaling 384..462 CDD:238492
SH3_DLG3 502..568 CDD:212962
Guanylate_kin 658..836 CDD:395500 56/182 (31%)
SPBC1198.05NP_595074.1 Gmk 17..201 CDD:223272 56/182 (31%)
guanyl_kin 19..201 CDD:213788 56/182 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.