DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chil-24 and Cht10

DIOPT Version :9

Sequence 1:NP_494455.1 Gene:chil-24 / 173661 WormBaseID:WBGene00020407 Length:410 Species:Caenorhabditis elegans
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:416 Identity:88/416 - (21%)
Similarity:168/416 - (40%) Gaps:93/416 - (22%)


- Green bases have known domain annotations that are detailed below.


 Worm    23 VCRHCHEKQDSTFFSIHSNYKMSNNETETTPS----RIVGFYADWE----------RTDITSHQV 73
            |.:.|..:.:.....:..|:.:.....|.|..    :|:.::.:|.          ..||.|.  
  Fly  1374 VMQTCENEGEEHEGILDPNHVLEEENIEATEMATEFKIICYFTNWAWYRQGGGKFLPEDIDSD-- 1436

 Worm    74 AKLTHAVFAYVQMKFDGSLGFKNDAARIRFSNLRDKVRRNEDSNVKMMISIGGFENS--QHFYPV 136
             ..||.::.:..:..|......:|:.....:...:::........|:.::|||:.:|  ..:..:
  Fly  1437 -LCTHIIYGFAVLSRDNLTIQPHDSWADLDNKFYERIVAYRKKGAKVTVAIGGWNDSAGDKYSRL 1500

 Worm   137 LSNVEMKKAFLNSISSFLAYHELHGVDIFWKWP----------SPEDKAHYSRFLADLRQHLGYE 191
            :.|.|.:..|:.::..|:..:...|:|:.|::|          :.|:|..:|.    |.:.|.|.
  Fly  1501 VRNPEARSRFIRNVLDFIEEYNFDGLDLDWEYPVCWQVDCKKGTAEEKIGFSA----LVRELFYA 1561

 Worm   192 F-----IISVAV-PQAEVSNLELGYDLRTISSHVDFFNVHSMDYYGPWPNEWGKPTGPISPLY-- 248
            |     |:|.|| |..:|  ::.||::..:|.:..:.:|.:.||:|    :|.|.||.::|:|  
  Fly  1562 FQPRGLILSAAVSPNKKV--IDAGYEVAELSHYFSWISVMAYDYHG----QWDKKTGHVAPMYSH 1620

 Worm   249 --GPTRHNVDWTLRYYAEKTGEPGKLNMVIPFFVRLWKNVPEPVEPGRQVFRDVELVD---NKP- 307
              |....|.::::.|:.....:..||.|.||.:              .|.|...|...   |.| 
  Fly  1621 PEGTANFNANFSMNYWISMGADRRKLVMGIPLY--------------GQSFSLAETTKHQLNAPT 1671

 Worm   308 -----QGEAYMSRWSAQHEELDLSPADWDEETRSSYTWN--PDTR-----------NFVTFETDK 354
                 .|||..:|....:.|:.|.        ...:.||  .||:           .:|:|:...
  Fly  1672 YGGGEAGEATRARGFLAYYEICLK--------IRHHRWNVVRDTKGRIGPFAYHGDQWVSFDDVP 1728

 Worm   355 SIQEKMKYVKEKNLGGVWIWHVDANE 380
            .|:.|.:|:|...|||..||.:|.::
  Fly  1729 MIRHKSEYIKAMGLGGAMIWALDLDD 1754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chil-24NP_494455.1 Glyco_18 55..378 CDD:214753 82/376 (22%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 83/377 (22%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 83/379 (22%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164212
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.