DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F52C6.2 and Ubi-p5E

DIOPT Version :9

Sequence 1:NP_494128.3 Gene:F52C6.2 / 173558 WormBaseID:WBGene00018659 Length:228 Species:Caenorhabditis elegans
Sequence 2:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster


Alignment Length:258 Identity:81/258 - (31%)
Similarity:123/258 - (47%) Gaps:70/258 - (27%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MLLSIKTSTGKTITVEAPKS-----VKTEVRYKQGV-------VFAVSYDKDAGNQIIEMED--T 51
            |.:.:||.||||||:|...|     ||.:::.|:|:       :|       ||.|   :||  |
  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF-------AGKQ---LEDGRT 55

 Worm    52 VQDVKIQEAQQ----APLRESEEV-----TGDPI--KVEASDT--NRNEENPDLAGPPAEPVIRG 103
            :.|..||:...    ..||...::     ||..|  :||.|||  |...:..|..|.|.:     
  Fly    56 LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD----- 115

 Worm   104 TAASGRIVNVRLAGKRIVQPNRRFTSYLPSSAVRRVASPYQIRRVS-------VDGNFNVFVKNS 161
               ..|::   .|||::..              .|..|.|.|::.|       :.|...:|||..
  Fly   116 ---QQRLI---FAGKQLED--------------GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL 160

 Worm   162 TGGKTTAVSIKNTDTIGTLKLKVQEKEGIPPNQQRLLFKGSELMDYRTVAHCGLRQGTSLDLV 224
            | |||..:.::.:|||..:|.|:|:||||||:||||:|.|.:|.|.||::...:::.::|.||
  Fly   161 T-GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F52C6.2NP_494128.3 ubiquitin 157..224 CDD:365970 30/66 (45%)
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 27/84 (32%)
UBQ 1..72 CDD:214563 25/80 (31%)
Ubiquitin 77..152 CDD:176398 21/99 (21%)
UBQ 77..148 CDD:214563 21/95 (22%)
Ubiquitin 153..228 CDD:176398 32/71 (45%)
UBQ 153..224 CDD:214563 32/71 (45%)
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.