DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment clec-117 and nw

DIOPT Version :9

Sequence 1:NP_493698.1 Gene:clec-117 / 173417 WormBaseID:WBGene00015193 Length:185 Species:Caenorhabditis elegans
Sequence 2:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster


Alignment Length:200 Identity:48/200 - (24%)
Similarity:74/200 - (37%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAF---HKLYHLKMNFPRAKKHCEQNGAHLAGIT 62
            |.|.:|..||  |..:.|.....|.:..:|:..|   ...|..::|:..|.::|...|..||...
  Fly     1 MAKIVLFCLL--SLLACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFE 63

 Worm    63 SREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGL--NATCSLSNVVQWLDNVAET 125
            ::|:|:.:......||..|..:|..|.|.|.  ||..: ...||  |||      ..:.:|.|:.
  Fly    64 TKEKAESMTTYLKNAGYGNYDFWTSGNRLGT--GMFLW-MSTGLPFNAT------FDFFENSADA 119

 Worm   126 I-----DPDWWKIPGPSHIPFNMPQQ------------CLSFVHGDRDWTTPNDPGFLDDIGCDV 173
            |     ||       ..|.....||:            |:........| .|.|...:.|..|:.
  Fly   120 IQAGLLDP-------VDHNSNTSPQRTARDSSSGAEKGCVILKQPTLKW-MPEDCSAVKDFICEQ 176

 Worm   174 PRKFF 178
            .|.::
  Fly   177 TRCYY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clec-117NP_493698.1 CLECT 35..179 CDD:153057 38/162 (23%)
nwNP_001027435.2 CLECT 31..176 CDD:153057 38/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.