DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y54E5B.2 and U3-55K

DIOPT Version :9

Sequence 1:NP_493584.1 Gene:Y54E5B.2 / 173352 WormBaseID:WBGene00013204 Length:861 Species:Caenorhabditis elegans
Sequence 2:NP_001014529.1 Gene:U3-55K / 3346176 FlyBaseID:FBgn0053505 Length:484 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:44/95 - (46%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


 Worm   125 WKPHEDEKPIMRKGHK----GMIFSIVTDSTRIFTISDDRTIRMWPIDDRESGPLCTVFGHTARP 185
            |.|...:.....|||:    |::|...|..  :::.:.||::::|.:|  |...:.::|||....
  Fly   241 WCPQTMKHIKTLKGHRDSVAGLVFRKGTHD--LYSAAKDRSVKIWSLD--EMAYVESLFGHQTAV 301

 Worm   186 FAICVDPINYRIYTGGIEQTLFCWKYDERS 215
            .:|........|..||.:.:|..||..|.|
  Fly   302 TSIDALSRERAITAGGSDCSLRIWKITEES 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y54E5B.2NP_493584.1 WD40 repeat 58..92 CDD:293791
WD40 112..>209 CDD:392136 21/87 (24%)
WD40 repeat 186..224 CDD:293791 9/30 (30%)
WD40 repeat 229..308 CDD:293791
WD40 repeat 316..346 CDD:293791
WD40 repeat 386..430 CDD:293791
WD40 571..817 CDD:392136
U3-55KNP_001014529.1 Upf2 55..>125 CDD:281974
WD40 <150..484 CDD:225201 25/95 (26%)
WD40 156..416 CDD:295369 25/95 (26%)
WD40 repeat 163..203 CDD:293791
WD40 repeat 218..254 CDD:293791 2/12 (17%)
WD40 repeat 259..295 CDD:293791 8/39 (21%)
WD40 repeat 302..336 CDD:293791 9/30 (30%)
WD40 repeat 342..379 CDD:293791
WD40 repeat 391..431 CDD:293791
WD40 repeat 436..461 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19865
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.