DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pas-5 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_492765.1 Gene:pas-5 / 172942 WormBaseID:WBGene00003926 Length:248 Species:Caenorhabditis elegans
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:245 Identity:82/245 - (33%)
Similarity:143/245 - (58%) Gaps:22/245 - (8%)


- Green bases have known domain annotations that are detailed below.


 Worm     6 SEYDRGVNTFSPEGRLFQVEYAIEAVKLGSTSIGIKTSEGVLLAAEKRSTSKLMVNDAIEKISKV 70
            |.|.|.:..|||:|.|.|||||.|||:.|||::|::.:..|:|..||.|.|::..:..:.|||.:
  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67

 Worm    71 DQHIGVTFAGLIADSRTLVERAQIEAQNFWFTYNRKIRVEDVTQSVANLALQFGDDDVKASMSRP 135
            |:|:.:.||||.||:|.|:.|.|:|.|:....:..::.:|.:|:.:|.|..::    .:.:..||
  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKY----TQCNGRRP 128

 Worm   136 FGVAMLFAGVDQEG-AKLFHLDPSGTFIDCKAKSIGAASDGAEQNLKEQY--HDALTIKEGLKMA 197
            ||::.|..|:|.:| |:|||.:|||.|.:.||.:.|..::...:..::.|  |:..|..:.:|:|
  Fly   129 FGISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLA 193

 Worm   198 LAILKQVMEEKLNSANVEVVVIKPTVDAKGRPIGEFTRVSNEELDQVITS 247
            :..|.:|.:  ::...:||.|::     .|:|:        :.||.|:.|
  Fly   194 MRALLEVTQ--MSQMRLEVAVLE-----NGKPM--------KMLDSVVIS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pas-5NP_492765.1 PRK03996 8..248 CDD:235192 81/243 (33%)
proteasome_alpha_type_5 8..219 CDD:239722 74/213 (35%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 81/243 (33%)
proteasome_alpha_type_7 5..213 CDD:239724 74/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.