DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp2 and HLH4C

DIOPT Version :9

Sequence 1:NP_032615.2 Gene:Mesp2 / 17293 MGIID:1096325 Length:370 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:131 Identity:38/131 - (29%)
Similarity:57/131 - (43%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    42 SCPCYATRRPSQPAGPARSTRTTQ------------ATAPRRTRPAPAGGQRQSASEREKLRMRT 94
            :|...|...|..|..||...|||.            :...||.|.......|.:.:.||::|:..
  Fly    59 ACETAAQPAPPPPPTPAPRRRTTPIAHLDPSELVGLSREERRRRRRATLKYRTAHATRERIRVEA 123

Mouse    95 LARALQELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSALLGLSEDSLRRRRRRSADAAFSHR 159
            ...:..|||:.||  ..|..:.|:|||.|:|||.||.:|:.:|....||       :..::|:..
  Fly   124 FNVSFAELRKLLP--TLPPDKKLSKIEILKLAICYIAYLNHVLETPXDS-------AGASSFATS 179

Mouse   160 C 160
            |
  Fly   180 C 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp2NP_032615.2 HLH 80..133 CDD:278439 20/52 (38%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.