DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp1 and Fer3

DIOPT Version :9

Sequence 1:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:165 Identity:50/165 - (30%)
Similarity:68/165 - (41%) Gaps:47/165 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 QPPMPSDGNSVCSPAWSSD----PWDGAQASSPAPPCARPARR--AG-----------------T 62
            |.|.|.|     .|.:..|    |..|.:|  |.||.. |.:.  ||                 .
  Fly     2 QHPHPID-----QPTYMPDVPFQPLWGQEA--PPPPIV-PYQELIAGFPCTDLSLWQRSQVTPLV 58

Mouse    63 PGRRGTHGSRLGS--------------GQRQSASEREKLRMRTLARALHELRRFLPPSVAPTGQN 113
            |.|..|:|...||              .||::|:.||:.||..|..|..:|||.:|.....  :.
  Fly    59 PQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYE--KR 121

Mouse   114 LTKIETLRLAIRYIGHLSAVLGLSEDNLRRQRHAV 148
            |::||||||||.|||.::.:|..:..|..:.|..|
  Fly   122 LSRIETLRLAITYIGFMAELLSGTPSNSHKSRSDV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 25/101 (25%)
HLH 77..130 CDD:278439 25/52 (48%)
CPLCP 153..157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Fer3NP_524322.1 HLH 87..135 CDD:278439 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.