DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp1 and twi

DIOPT Version :9

Sequence 1:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:139 Identity:47/139 - (33%)
Similarity:68/139 - (48%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 SDGN-SVCSPAWSSDP------WDGAQASSPAPPCARPARR-AGTPGRRGTHGSRLGSGQRQSAS 82
            ||.| .|.|||..:|.      .||:.|...|  ..:|.|| ...|.:  |..:...|.||..|:
  Fly   308 SDLNGGVMSPACLADDGSAGSLLDGSDAGGKA--FRKPRRRLKRKPSK--TEETDEFSNQRVMAN 368

Mouse    83 EREKLRMRTLARALHELRRFLP--PSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNLRRQR 145
            .||:.|.::|..|...|::.:|  ||     ..|:||:||:||.|||..|..:|..|:.:|.:  
  Fly   369 VRERQRTQSLNDAFKSLQQIIPTLPS-----DKLSKIQTLKLATRYIDFLCRMLSSSDISLLK-- 426

Mouse   146 HAVSPRGCP 154
             |:..:|.|
  Fly   427 -ALEAQGSP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 22/67 (33%)
HLH 77..130 CDD:278439 22/54 (41%)
CPLCP 153..157 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
twiNP_001033967.1 HLH 363..413 CDD:278439 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.