DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp1 and CG33557

DIOPT Version :10

Sequence 1:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:108 Identity:36/108 - (33%)
Similarity:48/108 - (44%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 DGNSVCSPAWSSDPWDGAQASSPAPPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKLRMRT 91
            |.||..|.:.|     ||.|.|......:.|    .||.:...|:......||..:.||:.|...
  Fly    21 DSNSSGSASGS-----GAAADSEDSQIGQEA----NPGGQENQGNHRRRPPRQKINARERYRTFN 76

Mouse    92 LARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSAVL 134
            :..|...||..:|  ..|..:.|:|||.:|||..||.|||:.|
  Fly    77 VNSAYEALRNLIP--TEPMNRKLSKIEIIRLASSYITHLSSTL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 16/58 (28%)
bHLH_SF 77..141 CDD:469605 23/58 (40%)
CPLCP 153..157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
CG33557NP_001014730.1 bHLH_TS_scleraxis_like 63..117 CDD:381471 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.