DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mesp1 and Fer1

DIOPT Version :9

Sequence 1:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:235 Identity:57/235 - (24%)
Similarity:95/235 - (40%) Gaps:63/235 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 DGNSVCSPAWSSDPWDGAQASSPAPPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKLRMRT 91
            |.:...|..::||..:..:...|.      :||:..| ||....|::.. |||:|:.||:.||::
  Fly    45 DEDDAYSSGFNSDQENTEKTFCPF------SRRSHKP-RRLKCASQMAQ-QRQAANLRERRRMQS 101

Mouse    92 LARALHELRRFLPPSVAPTGQNLTKIETLRLAIRYIGHLSAVL---------GLS-EDNLRRQRH 146
            :..|...||..:|  ..|..:.|:|::||:|||.||..||.::         ||| :.|.:::  
  Fly   102 INEAFEGLRTHIP--TLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKE-- 162

Mouse   147 AVSPRGCPLCPDSDLAQSQSLGPRLSPAVCSGVSW-GSPPAYPRPRVAAESWDPSF--------- 201
                      |...:......|     .|...:|| .....||..::.|.:|.|..         
  Fly   163 ----------PPKKIILKDRTG-----GVAHSLSWYRKGDRYPGSKLYARTWTPEDPRGPHSQPL 212

Mouse   202 -LYAETASQERQE---------------MEPSPSSPLFSS 225
             ||..:.|.:.|.               .:|..::.:|||
  Fly   213 PLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 16/58 (28%)
HLH 77..130 CDD:278439 22/52 (42%)
CPLCP 153..157 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228 6/37 (16%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.