DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mep1a and CG15253

DIOPT Version :9

Sequence 1:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:271 Identity:94/271 - (34%)
Similarity:134/271 - (49%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 FAIMLWIQPACLLSLIFSAHIAAVSIKHLLNGSDHDTDVGEQKDIFEINLAAGLNLFQGDILLP- 74
            ::|:|      ||.::.:...||.||:       .:||.         .|.||  ..:|| ::| 
  Fly     4 YSILL------LLLVVVNVAWAAPSIR-------IETDP---------ELTAG--YIEGD-MVPS 43

Mouse    75 -RTRNAMRDPSSRWKLPIPYI-LADNLELNAKGAILHAFEMFRLKSCVDFKPYEGESSYI--IFQ 135
             .:||..|:.:.||...|.|. :...::...:..|:.|.:.....||:.||....:..|.  :..
  Fly    44 GSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTS 108

Mouse   136 KLSGCWSMIG----DQQVG-QNISIGEGCDFKATIEHEILHALGFFHEQSRTDRDDYVNIWWDQI 195
            :..||:|.||    .||:. ||..||.||....||.||.||||||||:||..||||||.|..:.|
  Fly   109 EEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENI 173

Mouse   196 ITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNESIPTITTKIPEFNTIIGQLPDFSAI 260
            ....|.||:.|.:.|:.|....|||.|:|||||::|:||.. .||.........:|||..:.|..
  Fly   174 TEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE-RTILALEEGKEDVIGQRLELSET 237

Mouse   261 DLIRLNRMYNC 271
            |:.:||.:|.|
  Fly   238 DIRKLNAIYKC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 85/234 (36%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
CG15253NP_609758.1 Astacin 55..250 CDD:279708 75/195 (38%)
ZnMc_astacin_like 59..246 CDD:239807 71/187 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.