DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox2 and Antp

DIOPT Version :9

Sequence 1:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:280 Identity:77/280 - (27%)
Similarity:106/280 - (37%) Gaps:81/280 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 PHATAQGLHPFSQ-------SSLALHGRSDHMS-YPELSTSSSSCIIAGYPNEEGMFASQHHRGH 68
            |..|.|..||..|       :|..|......:. .||..:......::|: :........||.||
  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGH-HMNAQMTLPHHMGH 203

Mouse    69 H-----------------HHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGP 116
            .                 |.:||:...:|||.        .:|.:.:||....|      ...||
  Fly   204 PQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQS--------GVPPVGAPPQGMMH------QGQGP 254

Mouse   117 PELGS------SPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPADVEKRSGSKRKSDSSDSQE 175
            |::..      :||....||.|.|..:|              |.|         ..:|.....||
  Fly   255 PQMHQGHPGQHTPPSQNPNSQSSGMPSP--------------LYP---------WMRSQFGKCQE 296

Mouse   176 GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK 240
                      .::.|..:|:.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||
  Fly   297 ----------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351

Mouse   241 WKRVK--GGQQGAAAREKEL 258
            ||:..  .|:.|:.....|:
  Fly   352 WKKENKTKGEPGSGGEGDEI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 29/150 (19%)
Homeobox 190..242 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/192 (18%)
Homeobox 301..354 CDD:395001 33/52 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.