DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox2 and Scr

DIOPT Version :9

Sequence 1:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:309 Identity:79/309 - (25%)
Similarity:109/309 - (35%) Gaps:106/309 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    20 HPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHH---------- 74
            |..:|::....|..|.:.|.:|             ..:.:...|..:.....|.|          
  Fly    94 HYANQAAYGGQGNPDMVDYTQL-------------QPQRLLLQQQQQQQQQQHAHAAAAVAAQQQ 145

Mouse    75 ---HHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGG--------------------- 115
               ....|.|||.|..|:|......:.|.:..        .|||                     
  Fly   146 QQLAQQQHPQQQQQQQQANISCKYANDPVTPG--------GSGGGGVSGSNNNNNSANSNNNNSQ 202

Mouse   116 ----PPELGS---SPPVLCS----------NSSSLGSSTPTGAACA--------------PGDYG 149
                |.:|.:   ||.:..|          |...||.|....||.|              ||:..
  Fly   203 SLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPGNVN 267

Mouse   150 RQALSPADVEKRSGSKRKSDSSDSQ-EGNYKS-------------------EVNSKPRKERTAFT 194
            ....||...:..|.|...:::..|| .||.|.                   ..|.:.:::||::|
  Fly   268 VPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYT 332

Mouse   195 KEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 243
            :.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||||:
  Fly   333 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 38/212 (18%)
Homeobox 190..242 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 34/52 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.