powered by:
Protein Alignment Meox1 and Antp
DIOPT Version :9
Sequence 1: | XP_036012267.1 |
Gene: | Meox1 / 17285 |
MGIID: | 103220 |
Length: | 271 |
Species: | Mus musculus |
Sequence 2: | NP_996167.1 |
Gene: | Antp / 40835 |
FlyBaseID: | FBgn0260642 |
Length: | 378 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 18/58 - (31%) |
Similarity: | 28/58 - (48%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
Mouse 198 SKDQNQERLKEPPLQFPPPGPTLSHLWTHP----GQPAHTLRCEVAQYVGALNF-PEG 250
|::|.|::.::.|.|.....|.::...||| .||.....|::...||.|.. |||
Fly 120 SQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEG 177
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Meox1 | XP_036012267.1 |
None |
Antp | NP_996167.1 |
KLF1_2_4_N |
<161..306 |
CDD:425360 |
7/17 (41%) |
Homeobox |
301..354 |
CDD:395001 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.