DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox1 and ftz

DIOPT Version :9

Sequence 1:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:226 Identity:42/226 - (18%)
Similarity:68/226 - (30%) Gaps:72/226 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 NPHS-----EDSSASGL---------SHYPPTPFS----FHQKSDFPATAAYP------------ 58
            :|||     .|:|.|..         .:||...:|    ::...:...|...|            
  Fly    23 HPHSLPPTYYDNSGSNAYYQNTSNYQGYYPQESYSESCYYYNNQEQVTTQTVPPVQPTTPPPKAT 87

Mouse    59 -----DFSASCLAATPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGS 118
                 |.:||.:||..........:..........|||:.:...|   ::...||.|.:...:.:
  Fly    88 KRKAEDDAASIIAAVEERPSTLRALLTNPVKKLKYTPDYFYTTVE---QVKKAPAVSTKVTASPA 149

Mouse   119 PG-----LVDGTAGLGEDCMVLGTIANETEKKSSRRKKERSGQSLVPEPE--------DEVET-- 168
            |.     :...|....||...|     :.....|:.:|.::|....|.|.        :.:.|  
  Fly   150 PSYDQEYVTVPTPSASEDVDYL-----DVYSPQSQTQKLKNGDFATPPPTTPTSLPPLEGISTPP 209

Mouse   169 ---CEGGSACV-----------PTGAGPRGW 185
               .|..|:.|           |.|||...|
  Fly   210 QSPGEKSSSAVSQEINHRIVTAPNGAGDFNW 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox1XP_036012267.1 None
ftzNP_477498.1 FTZ 1..248 CDD:281812 42/226 (19%)
Homeobox 257..310 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.