DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Meox1 and unpg

DIOPT Version :9

Sequence 1:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:251 Identity:52/251 - (20%)
Similarity:77/251 - (30%) Gaps:101/251 - (40%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 PQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSFHQ-KSDFPATAAYP--------DFSASCLAA 67
            ||||.|                    :|||    |. :...|.|..:|        :.:|:.:|.
  Fly   129 PQPPPP--------------------HPPT----HALEKQLPPTLPHPLDTRFLPFNPAAAGVAP 169

Mouse    68 TPHSLPRTERIFNE------------QHPAF------------------PQTPDWHFPISEAGQR 102
            |..|..|...:.|:            ||.|.                  |..|..|...:::|..
  Fly   170 TDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSH 234

Mouse   103 LNLGPAGSAREMGAGSPGLVDGTAGLGEDCMVLGTIANETEKKSSRRK------KERSGQSLVPE 161
            ..:.||             :|  .|:.||....|...::.....|.|.      |.|:|.....:
  Fly   235 SPMEPA-------------LD--VGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSD 284

Mouse   162 PEDEVETC----------EGGSACVPTGAGPRGWGLCSFSKFRVRCSKDQNQERLK 207
            .||    |          |||..   .|...:|.|..|.||.|.|.:...:::.|:
  Fly   285 SED----CSDDEGAQSRHEGGGM---GGKDSQGNGSSSNSKSRRRRTAFTSEQLLE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Meox1XP_036012267.1 None
unpgNP_477146.1 Homeobox 324..375 CDD:278475 1/10 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.