DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Melk and CG9222

DIOPT Version :9

Sequence 1:NP_034920.2 Gene:Melk / 17279 MGIID:106924 Length:643 Species:Mus musculus
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:261 Identity:99/261 - (37%)
Similarity:155/261 - (59%) Gaps:17/261 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 LYETIGTGGFAKVKLACHVLTGEMVAIKIMDKNALGSD-----LPRVKTEIDALKSLRHQHICQL 72
            |.:.||||.:||||:......|:.||:||:.|....|:     |||   ||:|:|.|.|:::...
  Fly    78 LGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPR---EIEAVKGLHHENLITF 139

Mouse    73 YHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQILSAVAYVHSQGYAHRDLKPEN 137
            |..:||.::::::::....|.|.||:..:..|.|.::|.:|:|::|||.|:||:|..|||:|.||
  Fly   140 YQSIETSHRVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDIKCEN 204

Mouse   138 LLFDENHKLKLIDFGLCAKPKGNKDYHL---QTCCGSLAYAAPELIQGKSYLGSEADVWSMGILL 199
            ||.|||..|||||||...|.....|..:   :|.|||.|||:||:::|.:|....:|:|:.|::.
  Fly   205 LLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIWACGVVC 269

Mouse   200 YVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQ--VDPKK-RISMRNLLNHP 261
            |.::.|.||:|..||..|.|:|.: ....||  |||:....:.|:.  :.|.| |.::..:...|
  Fly   270 YAMVFGRLPYDGSNVHILLKRINQ-SLVFPK--SPSASSECKHMIMHILAPVKIRYNIPQVKEDP 331

Mouse   262 W 262
            |
  Fly   332 W 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MelkNP_034920.2 STKc_MELK 7..263 CDD:270980 99/261 (38%)
S_TKc 11..263 CDD:214567 99/261 (38%)
UBA_MELK 281..332 CDD:270526
UBA-like. /evidence=ECO:0000250 282..321
Autoinhibitory region. /evidence=ECO:0000250 326..643
MELK_C 547..641 CDD:213383
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 99/261 (38%)
S_TKc 78..332 CDD:214567 97/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.