DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYB5R3 and CG11257

DIOPT Version :10

Sequence 1:NP_001165131.1 Gene:CYB5R3 / 1727 HGNCID:2873 Length:334 Species:Homo sapiens
Sequence 2:NP_611419.1 Gene:CG11257 / 37227 FlyBaseID:FBgn0034442 Length:535 Species:Drosophila melanogaster


Alignment Length:261 Identity:61/261 - (23%)
Similarity:113/261 - (43%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    73 DIKYPLRLIDREIISHDTRRFRFALPS--PQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDD 135
            |..:...::..:..:||:  |...|.|  .:.::.||.|.|:.:...::|.::.|.|||:    |
  Fly   290 DETFEYEVVHSKDFNHDS--FELCLQSVGQKVLMVLPAGYHVDIEVPLEGRVIQRSYTPV----D 348

Human   136 KGFVDL-------------VIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGK 187
            ..::.|             :||.|         ..|.:|.:|:.::.|..:.:..|        :
  Fly   349 HTYLRLENIRSSRSECLHFLIKRY---------PNGPVSSHLQKLETGSRVHWSAP--------R 396

Human   188 GKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMK-DPDDHTVCHLLFANQTEKDILL 251
            |.|.:..       :...:::.::|.|:|:||:|.:|:.|:| :.:......||:.|:|.:||.|
  Fly   397 GSFQLSD-------LTAHRNILLLAAGSGLTPILSLIQPILKRNTNRIESLQLLYFNKTNEDIWL 454

Human   252 RPELEELRNKHSARFKLWYTLDRAPEAWDY-GQGFVNEEMIR-DHLPP------PEEEPLVLMCG 308
            :.:|.||           :|.|......:| .|...|.:.|. :.|.|      ||....||:||
  Fly   455 KEKLHEL-----------HTDDERFSCTNYVSQSEDNPQRIALELLAPLFQKNQPERCTYVLICG 508

Human   309 P 309
            |
  Fly   509 P 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYB5R3NP_001165131.1 PLN02252 <71..334 CDD:215141 61/261 (23%)
CG11257NP_611419.1 Cyt-b5 91..163 CDD:459698
p23_NCB5OR 190..276 CDD:107240
cyt_b5_reduct_like 295..533 CDD:99780 60/256 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.