DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rskn-2 and S6k

DIOPT Version :9

Sequence 1:NP_001348666.1 Gene:rskn-2 / 172581 WormBaseID:WBGene00008311 Length:773 Species:Caenorhabditis elegans
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:352 Identity:155/352 - (44%)
Similarity:228/352 - (64%) Gaps:12/352 - (3%)


- Green bases have known domain annotations that are detailed below.


 Worm     2 EDILMPEGEKVSMENFALLRVLGKGAYGKVFLVRKVGGKDHNTIYAMKVLRKTRVLTKQKTLEHT 66
            |:.:.|...|:..::|.|.:|||||.|||||.|||..|:|.|..:|||||:|..::|.||...||
  Fly    62 EENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHT 126

 Worm    67 MAERQVLERLRGTPFLVNLFYAFQTDTKLHIVMEYVRGGELFTHLCSRGHFDLEAARFVIAELVV 131
            .|||.:||.:: .||:|.|.||||||.||::::||:.|||||.||...|.|..:...|.::|:::
  Fly   127 RAERNILEAVK-HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIIL 190

 Worm   132 AIDSLHQRKVIYRDLKLENILLDEEGHVKLTDFGLSKLFLPGELDRANSYCGTIEYMSPEVINRP 196
            |:..||:..:||||||.||||||.:||||||||||.|..:. |....:::|||||||:||::.| 
  Fly   191 ALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQ-EGIVTHTFCGTIEYMAPEILTR- 253

 Worm   197 EGGYSDVVDWWSLGVISFELLTGCSPFTVDGAQNSSKDIAKRIMTKKVPFPKTMDVDARDFIGQL 261
             .|:...|||||||.:.|::|||..|||   |:|..|.| :.|:..|:..|..:..:|||.:.:|
  Fly   254 -SGHGKAVDWWSLGALMFDMLTGVPPFT---AENRKKTI-ETILKAKLNLPAYLTPEARDLVRRL 313

 Worm   262 LEKKLEKRLGYNGVD--EIKNHKFMSSIDWDAAVKRTLKPVIVPRIGHDLDTQFFSAEFTSQPPL 324
            ::::..:|||....|  .::.|.|...::||..:.|.|:|.|.|.:..:.|...|...||.|.|:
  Fly   314 MKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPV 378

 Worm   325 YSPAESPL--NANTLFRGYSYVSPSVI 349
            .||.::.|  :||.:|:|::||:||::
  Fly   379 DSPDDTTLSESANLIFQGFTYVAPSIL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rskn-2NP_001348666.1 PKc_like 22..287 CDD:328722 126/266 (47%)
S_TK_X 285..344 CDD:214529 20/60 (33%)
STKc_MSK_C 374..694 CDD:270994
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 147/328 (45%)
STKc_p70S6K 81..402 CDD:270736 148/328 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R469
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.