DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mea1 and CG14341

DIOPT Version :9

Sequence 1:NP_001264238.1 Gene:Mea1 / 17256 MGIID:96957 Length:215 Species:Mus musculus
Sequence 2:NP_608580.2 Gene:CG14341 / 33301 FlyBaseID:FBgn0031315 Length:180 Species:Drosophila melanogaster


Alignment Length:180 Identity:40/180 - (22%)
Similarity:63/180 - (35%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    59 PNQTEDLGPHQGPT----EGTGDWSSEEPEEEQEETGAGPAGYSYQPL-------NQDPEQ---- 108
            |....|.|....||    ...|...||:.::.....|       ||||       ..|||:    
  Fly     4 PELPSDPGQEGLPTPPVDHPRGGVESEDDDDSDAYDG-------YQPLALDEENDAADPEEMSRE 61

Mouse   109 ---------EEVEL--APVGEGEDGAADIQDRIQALGLHLPDPPLESEDEDEEGAAALSSHSSIP 162
                     |:|:|  |||..|:.....|:             |.:.|.|.:..:........:.
  Fly    62 QETPSADNDEDVDLMTAPVTHGDPNMPAIE-------------PADVEIERQVWSEPRPRELQMD 113

Mouse   163 MDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASP 212
            :|....|.:.:.|:.::||...||.|||.:.:..|:..:...:..|...|
  Fly   114 LDKTRTEQILKAMSTITLPNITVPDWARGVPEEHWKHELLDRINNRHHPP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mea1NP_001264238.1 MEA1 42..215 CDD:284358 40/180 (22%)
CG14341NP_608580.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR17005
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.