Sequence 1: | NP_491688.1 | Gene: | hmg-3 / 172250 | WormBaseID: | WBGene00001973 | Length: | 689 | Species: | Caenorhabditis elegans |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138203.1 | Gene: | Dsp1 / 117294 | FlyBaseID: | FBgn0278608 | Length: | 397 | Species: | Drosophila melanogaster |
Alignment Length: | 290 | Identity: | 77/290 - (26%) |
---|---|---|---|
Similarity: | 117/290 - (40%) | Gaps: | 72/290 - (24%) |
- Green bases have known domain annotations that are detailed below.
Worm 440 YGSSDEDDIDPYKSTVKAEGREQDDDSDDESTDEDYDLDKDMKKQKNDKDSSEGSGSEPDDEYDS 504
Worm 505 GSEKDASGTG-----------------ESDPDEENI----------EPKKKESKEKKNKREKKEK 542
Worm 543 -------------PVKEKAVKKGKK---TKDPNEPKRATTAYIIWF-NANRNSMK----EDGDTL 586
Worm 587 GDVAKKAGAKWKSMSADDKKEWNDKAAQDKARYEAEMKEYKKNGGGVEKASGPSTKKSSDQSPGK 651
Worm 652 ------------QFKSKEHISDTDDSDDDE 669 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hmg-3 | NP_491688.1 | POB3 | 20..497 | CDD:227494 | 5/56 (9%) |
SSrecog | 75..285 | CDD:281523 | |||
PH2_SSRP1-like | 332..429 | CDD:270051 | |||
HMGB-UBF_HMG-box | 561..624 | CDD:238686 | 28/67 (42%) | ||
Dsp1 | NP_001138203.1 | HMG-box | 182..252 | CDD:294061 | 13/69 (19%) |
HMGB-UBF_HMG-box | 275..339 | CDD:238686 | 27/66 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |