DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcl1 and Debcl

DIOPT Version :9

Sequence 1:NP_032588.1 Gene:Mcl1 / 17210 MGIID:101769 Length:331 Species:Mus musculus
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:236 Identity:53/236 - (22%)
Similarity:91/236 - (38%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse   132 AKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRR 196
            |.|:.:..|...|....:|.:.|:..|...:..:|:|.:         |..||...|:..:.||.
  Fly    74 AASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRAR---------LRRAGVLNRKVTQRLRN 129

Mouse   197 V-------------------GDGVQRNHETAFQGMLRKLDIKNEGDVKS-------FSRVMVHVF 235
            :                   |:.::|.|...:..:.|:|.....|:::.       .:.|...:|
  Fly   130 ILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLF 194

Mouse   236 KDGVTNWGRIVTLISF-GAFVAKHLKSVNQESF------IEPLAETITDVLVRTKRDWLVKQRGW 293
            :..:| ||:|:::.:. |.|.   :..|.|..|      |:.|||.|.|.||.    ||:...||
  Fly   195 RSSIT-WGKIISIFAVCGGFA---IDCVRQGHFDYLQCLIDGLAEIIEDDLVY----WLIDNGGW 251

Mouse   294 DGFVEFFHVQDLEGGIRNVLLAFAG----VAGVGAGLAYLI 330
            .|...  |::...|.     ..|.|    ...:.|| ||::
  Fly   252 LGLSR--HIRPRVGE-----FTFLGWLTLFVTISAG-AYMV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcl1NP_032588.1 PEST-like. /evidence=ECO:0000250 85..156 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..154 5/21 (24%)
Bcl-2_like 156..299 CDD:132900 39/175 (22%)
BH3 190..204 3/32 (9%)
BH1 234..253 5/19 (26%)
BH2 285..300 5/14 (36%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.