powered by:
Protein Alignment acbp-1 and anox
DIOPT Version :9
Sequence 1: | NP_491412.1 |
Gene: | acbp-1 / 172071 |
WormBaseID: | WBGene00016655 |
Length: | 86 |
Species: | Caenorhabditis elegans |
Sequence 2: | NP_001027085.1 |
Gene: | anox / 3771728 |
FlyBaseID: | FBgn0064116 |
Length: | 243 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 39/73 - (53%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Worm 10 ATVKTLKTSPS--NDELLKLYALFKQGTVGDNTTDKPGMFDLKGKAKWSAWDEKKGLAKDDAQKA 72
||....|.|.| :.:||..|..:||.|.|......||:..|:.|:||.||.....:::..|::|
Fly 16 ATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQA 80
Worm 73 YVALVEEL 80
||..::||
Fly 81 YVQKLQEL 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.