DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bet-1 and tbrd-3

DIOPT Version :9

Sequence 1:NP_001366626.1 Gene:bet-1 / 172054 WormBaseID:WBGene00022473 Length:857 Species:Caenorhabditis elegans
Sequence 2:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster


Alignment Length:246 Identity:60/246 - (24%)
Similarity:104/246 - (42%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


 Worm   261 PSMKPCLKLLNDFSTKKYQEFAWPFNEPVDAEQLGLHDYHKIIKEPMDLKSMKAKMESGAYKEPS 325
            |.:..|..::....:..|:..||.|.||:|.:.|||||||:|::|||||.:::.::.:|.|...:
  Fly    12 PEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAA 76

 Worm   326 DFEHDVRLMLRNCFLYNPVGDPVHSFGLRFQEVFDRRWAEL---------------------GDS 369
            ||..|:||:..|.:||.......:....:.|.:|:..::::                     .||
  Fly    77 DFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEESSSDESDS 141

 Worm   370 SS-----RASSVAP--QSAP--------IAPT-----PKVAKSSAPKEP---KESRKEHKKETTF 411
            ||     ..|.|:|  ..||        ..||     |...::|..:||   :|....|.|....
  Fly   142 SSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEEDLDLHAKIQQL 206

 Worm   412 EASGAKSEDLMQINNALSMIRERE--------EKLKAELAAAQAIKDKLTS 454
            :     .|.|:.:.:.:..:...|        :..|.::...:.|:|.|.|
  Fly   207 D-----GEVLLHVIHFIQRMEGAEYCNKELEFDICKLKVHTKRGIRDYLAS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bet-1NP_001366626.1 Bromo_Brdt_I_like 39..145 CDD:99929
PLN02967 95..>240 CDD:215521
Bromo_Brdt_II_like 262..363 CDD:99930 33/100 (33%)
Ribosomal_P1_P2_L12p <371..416 CDD:419700 15/67 (22%)
BET 526..592 CDD:407211
DMRT-like <684..730 CDD:374115
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/100 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.